PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10006826
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB_related
Protein Properties Length: 333aa    MW: 36533.4 Da    PI: 6.5798
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10006826genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.53.2e-1373117347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
      Lus10006826  73 PWTEEEHRLFLIGLQKLGKGDWRGIARNYVVSRTPTQVASHAQKY 117
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.93866122IPR017930Myb domain
SuperFamilySSF466893.07E-1767123IPR009057Homeodomain-like
TIGRFAMsTIGR015577.4E-1969121IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.2E-1170116IPR009057Homeodomain-like
SMARTSM007175.5E-1070120IPR001005SANT/Myb domain
CDDcd001673.23E-973118No hitNo description
PfamPF002497.9E-1173117IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGNLSAHYHS SSPAASPNPD SHSSSPAASP NPDSPVSDHA RDSGRLADGY LSDDPAHASS  60
SSNRRGYRKK GVPWTEEEHR LFLIGLQKLG KGDWRGIARN YVVSRTPTQV ASHAQKYFIR  120
QNNATRRKRR SSLFDMVTDL ASDPPHSVPE EKELFSLQAK ESNNADNHPS LNLSLKPDYE  180
PMETTSEEPA NEEEEAQETT MRSNESILHA PRPTQFTLFA PSQTSEFTPF VHQFVPAYVP  240
VPYPFWPANP VPVEQTMVTE TSNHQVLRPV AVVPKQPVNV DELVGISNLS IGDSSPSPLS  300
LKLTSETSRH SAFQANAPVS RPEISKGKIQ AV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012069084.11e-137PREDICTED: myb-like protein H
TrEMBLA0A067KXJ71e-137A0A067KXJ7_JATCU; Uncharacterized protein
STRINGPGSC0003DMT4000679941e-112(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.13e-54MYB_related family protein